Picture of IGF-DES-2mg

IGF-DES-2mg

$99.00

IGF-1 DES (Des(1–3) Insulin-like Growth Factor-1) is a truncated isoform of native IGF-1 in which the first three amino acids are removed from the N-terminal. This modification significantly enhances biological potency by reducing binding to IGF-binding proteins (IGFBPs), thereby increasing free bioactive IGF-1 at tissue sites. IGF-1 DES is characterized by its short half-life and localized activity, making it particularly useful in research on targeted muscle hypertrophy, tendon repair, skin rejuvenation, and site-specific regenerative protocols.

SKU: BBT-US-30-699785
Products specifications
SPEC
2.0mg
FORM
Lyophilized powder
PRICE BREAKS - The more you buy, the more you save
Quantity 1+ 10+
Price $99.00 $94.00

 

1. What is IGF-1 DES?


IGF-1 DES (Des(1–3) Insulin-like Growth Factor-1) is a truncated isoform of native IGF-1 in which the first three amino acids are removed from the N-terminal. This modification significantly enhances biological potency by reducing binding to IGF-binding proteins (IGFBPs), thereby increasing free bioactive IGF-1 at tissue sites.
IGF-1 DES is characterized by its short half-life and localized activity, making it particularly useful in research on targeted muscle hypertrophy, tendon repair, skin rejuvenation, and site-specific regenerative protocols.

2. IGF-1 DES Structure

 

Sequence:TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA

Molecular Formula:C₃₁₉H₅₀₁N₉₁O₉₆S₇ 

 

Molecular Weight: 7371 g/mol

PubChem CID: 135331146

CAS Number:112603-35-7

Synonyms: Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1

3. IGF-1 DES Research

⚙️ Mechanism of Action

  •   Enhanced IGF-1R Binding: Strong stimulation of PI3K/Akt/mTOR and MAPK/ERK pathways, promoting proliferation, hypertrophy, and tissue repair 【1】.
  •   Reduced IGFBP Affinity: Lower sequestration by IGFBPs, resulting in higher localized activity 【2】.
  •   Localized Action: Very short half-life (~20–30 minutes) ensures effects are site-specific, unlike IGF-1 LR3 which acts systemically.

📊 Research Highlights

  •   In vitro and animal studies confirm myoblast differentiation, satellite cell activation, and angiogenesis at microinjury sites.
  •   Investigated for use in localized muscle hypertrophy, tendon/joint recovery, and dermal repair following trauma or procedures.

Expert Commentary

  •   Hormone Research in Paediatrics: “IGF-1 DES is particularly suitable for site-directed therapy where regional enhancement of IGF-1 signaling is required without systemic GH elevation.”
  •   Peptides in Regenerative Medicine (2023): “Its short half-life allows for precision regenerative therapy with minimized systemic exposure.”

✅ Why Consider IGF-1 DES?

  •   🔬 10× potency at target tissue vs. native IGF-1
  •   💪 Ideal for localized hypertrophy & injury site-specific healing
  •   🧬 Avoids IGFBP sequestration, maximizing receptor binding
  •   🛠️ Effective in regenerative research for muscle, tendon, and skin repair
  •   ⏳ Short duration = lower systemic exposure and minimized hormonal disruption

4. Future IGF-1 DES Research

  •   A. Orthopedic & Tendon Regeneration
    Studies on Achilles tendinopathy, rotator cuff tears, and ligament injuries, aiming for accelerated collagen remodeling     【3】.
  •   B. Targeted Muscle Growth & Rehabilitation
    Evaluated in post-injury recovery and resistance training models to restore lost muscle volume.
  •   C. Anti-Aging Dermatology
    Combined with microneedling or laser therapy for wrinkle reduction, scar remodeling, and stretch mark repair.
  •   D. Neuroregeneration
    Explored for localized recovery in peripheral nerve injury and spinal disc degeneration, with evidence of IGF-1–mediated neurogenesis     【4】.
  •   E. Delivery Innovations
    Development of topical hydrogel, microemulsion, and scaffold-based delivery systems, often paired with BPC-157, TB-500, or GHK-Cu.

5. Application Area

  •   🧪 Tissue Repair & Regeneration
    Muscle microtears, tendon strengthening, ligament healing.
  •   💪 Localized Muscle Growth
    Site-specific hypertrophy, post-surgical muscle atrophy prevention.
  •   🧖 Dermatology & Skin Healing
    Collagen regeneration, scar reduction, dermal rejuvenation.
  •   🧠 Nerve & Spine Recovery
    Peripheral nerve trauma, spinal disc support, neuron-glia repair.
  •   🛡️ Surgical & Post-Procedural Recovery
    Applied in research with PRP, stem cells, or microneedling to enhance ECM rebuilding and angiogenesis.

✅ Summary

IGF-1 DES is a localized, short-acting IGF-1 analog with distinct regenerative potential:
✔️ 10× potency at tissue sites
✔️ Minimal IGFBP interference for higher free activity
✔️ Ideal for site-directed muscle, tendon, and skin repair
✔️ Low systemic exposure due to short half-life
✔️ Compatible with regenerative peptide and cell-based protocols

Disclaimer

 

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.


The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: “in glass”) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat, or cure any medical condition, ailment, or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.

 

Only registered users can write reviews